PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009602669.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 364aa    MW: 40476.9 Da    PI: 6.7148
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009602669.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.92e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +lv +++++G+g+W++++   g+ R+ k+c++rw +yl
   XP_009602669.1 14 KGPWTPEEDIILVSYIQEHGPGNWRAVPTNTGLLRCSKSCRLRWTNYL 61
                     79******************************99************97 PP

2Myb_DNA-binding49.31.1e-1567112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+ E++ ++++ ++lG++ W++Ia++++  Rt++++k++w+++l
   XP_009602669.1  67 RGNFTEHEEKMIIHLQALLGNR-WAAIASYLP-QRTDNDIKNYWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.4E-24564IPR009057Homeodomain-like
PROSITE profilePS5129423.977965IPR017930Myb domain
SuperFamilySSF466891.64E-3011108IPR009057Homeodomain-like
SMARTSM007172.0E-141363IPR001005SANT/Myb domain
PfamPF002493.9E-161461IPR001005SANT/Myb domain
CDDcd001672.63E-111661No hitNo description
Gene3DG3DSA:1.10.10.608.4E-2565117IPR009057Homeodomain-like
PROSITE profilePS5129419.60966116IPR017930Myb domain
SMARTSM007171.5E-1566114IPR001005SANT/Myb domain
PfamPF002492.8E-1467112IPR001005SANT/Myb domain
CDDcd001671.12E-1069111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 364 aa     Download sequence    Send to blast
MGRPPCCEKT GVKKGPWTPE EDIILVSYIQ EHGPGNWRAV PTNTGLLRCS KSCRLRWTNY  60
LRPGIKRGNF TEHEEKMIIH LQALLGNRWA AIASYLPQRT DNDIKNYWNT HLKKKLNKKL  120
EGHDQEGKSS SSSSSQSKIS KGQWEKRLQT DIHMAKQALC EALSLDIPSI GDSPNNNNNS  180
TPNLPVQEPV QTSTTYASSA ENIAKLLQNW MKNSPKSSSQ CRSSSKTTQM SSFNFPSIGA  240
VSSSSPSEGT INNATTQEGL DSLFHFNSSN NSDVSQSMSV DEGGNFTPEN NNAAIFQVES  300
KQNLPNYNFK AEINGSFHQE ESKPNLETQV PLTFLEKWLL DDNTNAQAQE ELMGMALSET  360
ADLF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-251411627128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009602669.10.0PREDICTED: myb-related protein 306-like
SwissprotP813921e-129MYB06_ANTMA; Myb-related protein 306
TrEMBLM1D6F51e-165M1D6F5_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000830761e-165(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28910.13e-96myb domain protein 30